Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF326 Rabbit Polyclonal Antibody (Biotin)

ZNF326 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZIRD, ZAN75, Zfp326, dJ871E2.1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF326

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ENPFEIQDHSQDQQIEGDEEDEEKIDEPIEEEEDEDEEEEAEEVGEVEEV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_861446

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XpressTM Human ARV7 Over-expressing Cell Line (LNCap)
ABC-X0249C 1 Vial

XpressTM Human ARV7 Over-expressing Cell Line (LNCap)

Sign In for Pricing
View Details
Human Hexosaminidase B Beta (HEXb) ELISA Kit
orb775581-01 48 Tests

Human Hexosaminidase B Beta (HEXb) ELISA Kit

Sign In for Pricing
View Details
Human Hexosaminidase B Beta (HEXb) ELISA Kit
orb775581-02 96 Tests

Human Hexosaminidase B Beta (HEXb) ELISA Kit

Sign In for Pricing
View Details
Kti12 Antibody
orb854739 2 mg

Kti12 Antibody

Sign In for Pricing
View Details
Mouse Dhrs11 Pre-designed siRNA Set A
SI103614A 1 Each

Mouse Dhrs11 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Candida albicans NADH-ubiquinone oxidoreductase chain 3 (NAD3)
MBS7022630-01 0.02 mg

Recombinant Candida albicans NADH-ubiquinone oxidoreductase chain 3 (NAD3)

Sign In for Pricing
View Details