Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABT1 Rabbit Polyclonal Antibody (HRP)

ABT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Esf2, hABT1

UniProt

Q9ULW3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ABT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFRDKRIAKRV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_037507

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RON (MST1R) (NM_002447) Human Over-expression Lysate
LS004486-20ug 20 µg

RON (MST1R) (NM_002447) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Adenylosuccinate lyase (purB)
MBS1100244-01 0.02 mg (E-Coli)

Recombinant Archaeoglobus fulgidus Adenylosuccinate lyase (purB)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Adenylosuccinate lyase (purB)
MBS1100244-02 0.02 mg (Yeast)

Recombinant Archaeoglobus fulgidus Adenylosuccinate lyase (purB)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Adenylosuccinate lyase (purB)
MBS1100244-03 0.1 mg (E-Coli)

Recombinant Archaeoglobus fulgidus Adenylosuccinate lyase (purB)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Adenylosuccinate lyase (purB)
MBS1100244-04 0.1 mg (Yeast)

Recombinant Archaeoglobus fulgidus Adenylosuccinate lyase (purB)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Adenylosuccinate lyase (purB)
MBS1100244-05 0.02 mg (Baculovirus)

Recombinant Archaeoglobus fulgidus Adenylosuccinate lyase (purB)

Sign In for Pricing
View Details