Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCLS1 Rabbit Polyclonal Antibody (HRP)

HCLS1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HS1, p75, CTTNL, lckBP1

UniProt

P14317

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HCLS1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_005326

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 3-amino-4- (isopropylsulphonyl) thiophene-2-carboxylate
OR25163 1 Each

Methyl 3-amino-4- (isopropylsulphonyl) thiophene-2-carboxylate

Sign In for Pricing
View Details
SSX5 (NM_021015) Human Recombinant Protein
TP302208M 100 µg

SSX5 (NM_021015) Human Recombinant Protein

Sign In for Pricing
View Details
STAM Antibody - N-terminal region
ARP63094_P050-25UL 25 µL

STAM Antibody - N-terminal region

Sign In for Pricing
View Details
Human anti-Epstein-Barr virus antibody, EBV ELISA Kit
NSL2378Hu 96 Tests

Human anti-Epstein-Barr virus antibody, EBV ELISA Kit

Sign In for Pricing
View Details
Thrombin Aptamer Lateral Flow Assay Kit
LF-020-10 10 Tests

Thrombin Aptamer Lateral Flow Assay Kit

Sign In for Pricing
View Details
Cell Stimulation Cocktail (500X) 4 x 100 uL
E16FXP048-4x100 4x 100 µL

Cell Stimulation Cocktail (500X) 4 x 100 uL

Sign In for Pricing
View Details