Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB48 Rabbit Polyclonal Antibody (HRP)

ZBTB48 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HKR3, TZAP, ZNF855, pp9964

UniProt

P10074

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB48

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005332

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEK3 (MAP2K3) pSer189 Rabbit Polyclonal Antibody
AP01635PU-N 100 µg

MEK3 (MAP2K3) pSer189 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Resazurin Cell Viability Assay Kit (10, 000 assays)
#30025-2 1 Kit

Resazurin Cell Viability Assay Kit (10, 000 assays)

Sign In for Pricing
View Details
ActinBriteTM 488/505 High Affinity Phalloidin Conjugate, 300 U
#00095 1x 300 U

ActinBriteTM 488/505 High Affinity Phalloidin Conjugate, 300 U

Sign In for Pricing
View Details
CDT2 (DTL) Rabbit Polyclonal Antibody
TA369945 100 µL

CDT2 (DTL) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ST8SIA5 activation kit by CRISPRa
GA109303 1 Kit

Human ST8SIA5 activation kit by CRISPRa

Sign In for Pricing
View Details
VN1R4 Antibody
8G794-AAT 50 µg

VN1R4 Antibody

Sign In for Pricing
View Details