Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB48 Rabbit Polyclonal Antibody (HRP)

ZBTB48 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HKR3, TZAP, ZNF855, pp9964

UniProt

P10074

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB48

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005332

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HACE1 Mouse Monoclonal Antibody [Clone ID: OTI6H8]
CF810071 100 µg

HACE1 Mouse Monoclonal Antibody [Clone ID: OTI6H8]

Sign In for Pricing
View Details
Glutathione S-Transferase Mu1 (GSTM1) (CPTC-GSTMu1-3), CF405S conjugate, 0.1mg/mL
BNC042241-100 1x 100 µL

Glutathione S-Transferase Mu1 (GSTM1) (CPTC-GSTMu1-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Isopropyl nitrile
TRC-I868310-25G 25 g

Isopropyl nitrile

Sign In for Pricing
View Details
(S)-3,5-Dihydroxylphenylglycine
TRC-D454520-10MG 10 mg

(S)-3,5-Dihydroxylphenylglycine

Sign In for Pricing
View Details
Human INSM2 activation kit by CRISPRa
GA113652 1 Kit

Human INSM2 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Myeloid tissue
CS630606 5x 5 µm

Frozen Tissue Sections, Myeloid tissue

Sign In for Pricing
View Details