Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNF4A Rabbit Polyclonal Antibody (HRP)

HNF4A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TCF, HNF4, MODY, FRTS4, MODY1, NR2A1, TCF14, HNF4a7, HNF4a8, HNF4a9, NR2A21, HNF4alpha

UniProt

P41235

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HNF4A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000448

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENO1 Rabbit Polyclonal Antibody
orb575055 100 µL

ENO1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SST antibody
BF0042 100 µg

SST antibody

Sign In for Pricing
View Details
LCK, Recombinant, Human, GST-Tag (Lymphocyte-specific Tyrosine Kinase, YT16, p56lck, pp58lck) discontinued
500206 10 µg

LCK, Recombinant, Human, GST-Tag (Lymphocyte-specific Tyrosine Kinase, YT16, p56lck, pp58lck) discontinued

Sign In for Pricing
View Details
Flowgen Comb 40 Sample MC 0.75mm Thick
MS2040MCSS075 1 Each

Flowgen Comb 40 Sample MC 0.75mm Thick

Sign In for Pricing
View Details
Recombinant Rat CCL4
6567 5 µg

Recombinant Rat CCL4

Sign In for Pricing
View Details
Rab5 Rabbit mAb
C05065-01 20 µL

Rab5 Rabbit mAb

Sign In for Pricing
View Details