Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXC4 Rabbit Polyclonal Antibody (FITC)

HOXC4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HOX3, cp19, HOX3E

UniProt

P09017

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HOXC4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQ

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_705897

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2741), CF405S conjugate, 0.1mg/mL
BNC042741-500 1x 500 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2741), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
[Bis(trifluoroacetoxy)iodo]benzene
TRC-B586600-5G 5 g

[Bis(trifluoroacetoxy)iodo]benzene

Sign In for Pricing
View Details
Human TMEM107 activation kit by CRISPRa
GA113508 1 Kit

Human TMEM107 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse REN1/Renin-1 Protein (His Tag)
PKSM041281-01 10 µg

Recombinant Mouse REN1/Renin-1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse REN1/Renin-1 Protein (His Tag)
PKSM041281-02 50 µg

Recombinant Mouse REN1/Renin-1 Protein (His Tag)

Sign In for Pricing
View Details
Galectin 13 (LGALS13) Rabbit Polyclonal Antibody
TA378002 100 µL

Galectin 13 (LGALS13) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details