Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JMJD8 Rabbit Polyclonal Antibody (FITC)

JMJD8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PP14397, C16orf20

UniProt

B2RNS7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LOC339123

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGDN

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001005920

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRK3 Rabbit pAb, BF700 conjugated
orb2822851 100 µL

GRK3 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
NPL, NT (NPL, C1orf13, N-acetylneuraminate lyase, N-acetylneuraminate pyruvate-lyase, N-acetylneuraminic acid aldolase, Sialate lyase, Sialate-pyruvate lyase, Sialic acid aldolase, Sialic acid lyase) (MaxLight 490)
MBS6326265-01 0.1 mL

NPL, NT (NPL, C1orf13, N-acetylneuraminate lyase, N-acetylneuraminate pyruvate-lyase, N-acetylneuraminic acid aldolase, Sialate lyase, Sialate-pyruvate lyase, Sialic acid aldolase, Sialic acid lyase) (MaxLight 490)

Sign In for Pricing
View Details
NPL, NT (NPL, C1orf13, N-acetylneuraminate lyase, N-acetylneuraminate pyruvate-lyase, N-acetylneuraminic acid aldolase, Sialate lyase, Sialate-pyruvate lyase, Sialic acid aldolase, Sialic acid lyase) (MaxLight 490)
MBS6326265-02 5x 0.1 mL

NPL, NT (NPL, C1orf13, N-acetylneuraminate lyase, N-acetylneuraminate pyruvate-lyase, N-acetylneuraminic acid aldolase, Sialate lyase, Sialate-pyruvate lyase, Sialic acid aldolase, Sialic acid lyase) (MaxLight 490)

Sign In for Pricing
View Details
AHSG Antibody
orb1176980 100 µg

AHSG Antibody

Sign In for Pricing
View Details
POTEH, NT (POTEH, A26C3, ACTBL1, POTE22, POTE ankyrin domain family member H, ANKRD26-like family C member 3, Prostate, ovary, testis-expressed protein on chromosome 22) (Biotin) discontinued
040283-Biotin 200 µL

POTEH, NT (POTEH, A26C3, ACTBL1, POTE22, POTE ankyrin domain family member H, ANKRD26-like family C member 3, Prostate, ovary, testis-expressed protein on chromosome 22) (Biotin) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal Mycobacterium Tuberculosis CFP10 Antibody [HRP]
NB110-58737H 0.1 mL

Rabbit Polyclonal Mycobacterium Tuberculosis CFP10 Antibody [HRP]

Sign In for Pricing
View Details