Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JMJD8 Rabbit Polyclonal Antibody (Biotin)

JMJD8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PP14397, C16orf20

UniProt

B2RNS7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LOC339123

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGDN

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001005920

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALKBH2 Antibody
orb75470 100 µL

ALKBH2 Antibody

Sign In for Pricing
View Details
Anti-Golden star tunicate fuhc Antibody (Dylight488 Conjugate)
DZ41036-Dylight488 200 µL

Anti-Golden star tunicate fuhc Antibody (Dylight488 Conjugate)

Sign In for Pricing
View Details
Lentiviral mouse Lman1 shRNA (UAS) - Lentiviral mouseLman1 shRNA (UAS, GFP) (25)
GTR15287060 1 Vial

Lentiviral mouse Lman1 shRNA (UAS) - Lentiviral mouseLman1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
SH3RF2, ID (SH3RF2, PPP1R39, RNF158, Putative E3 ubiquitin-protein ligase SH3RF2, Heart protein phosphatase 1-binding protein, Protein phosphatase 1 regulatory subunit 39, RING finger protein 158, SH3 domain-containing RING finger protein 2) (FITC)
MBS6347288-01 0.2 mL

SH3RF2, ID (SH3RF2, PPP1R39, RNF158, Putative E3 ubiquitin-protein ligase SH3RF2, Heart protein phosphatase 1-binding protein, Protein phosphatase 1 regulatory subunit 39, RING finger protein 158, SH3 domain-containing RING finger protein 2) (FITC)

Sign In for Pricing
View Details
SH3RF2, ID (SH3RF2, PPP1R39, RNF158, Putative E3 ubiquitin-protein ligase SH3RF2, Heart protein phosphatase 1-binding protein, Protein phosphatase 1 regulatory subunit 39, RING finger protein 158, SH3 domain-containing RING finger protein 2) (FITC)
MBS6347288-02 5x 0.2 mL

SH3RF2, ID (SH3RF2, PPP1R39, RNF158, Putative E3 ubiquitin-protein ligase SH3RF2, Heart protein phosphatase 1-binding protein, Protein phosphatase 1 regulatory subunit 39, RING finger protein 158, SH3 domain-containing RING finger protein 2) (FITC)

Sign In for Pricing
View Details
Anti-DLX1 Antibody (L43/40)
RHF15101 100 μg

Anti-DLX1 Antibody (L43/40)

Sign In for Pricing
View Details