Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFAP2E Rabbit Polyclonal Antibody (FITC)

TFAP2E Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AP2E, AP-2epsilon

UniProt

Q6VUC0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TFAP2E

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MLVHTYSAMERPDGLGAAAGGARLSSLPQAAYGPAPPLCHTPAATAAAEF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_848643

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse N-alpha-acetyltransferase 25, NatB auxiliary subunit (Naa25) , partial
MBS1339028 Inquire

Recombinant Mouse N-alpha-acetyltransferase 25, NatB auxiliary subunit (Naa25) , partial

Sign In for Pricing
View Details
ETV2 (NM_014209) Human Tagged ORF Clone Lentiviral Particle
RC213907L1V 200 µL

ETV2 (NM_014209) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MMP14 Protein Vector (Human) (pPM-C-HA)
30236021 500 ng

MMP14 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human SATB Homeobox Protein 1 (SATB1) ELISA Kit
MBS4502358-01 48 Tests

Human SATB Homeobox Protein 1 (SATB1) ELISA Kit

Sign In for Pricing
View Details
Human SATB Homeobox Protein 1 (SATB1) ELISA Kit
MBS4502358-02 96 Tests

Human SATB Homeobox Protein 1 (SATB1) ELISA Kit

Sign In for Pricing
View Details
Human SATB Homeobox Protein 1 (SATB1) ELISA Kit
MBS4502358-03 5x 96 Tests

Human SATB Homeobox Protein 1 (SATB1) ELISA Kit

Sign In for Pricing
View Details