Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF404 Rabbit Polyclonal Antibody (FITC)

ZNF404 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q494X3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF404

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YVCKECKKAFRSISGLSQHKRIHTGEKPYECKECDKAFNRSDRLTQHETI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001028891

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF-5 (F-11) Alexa Fluor® 546
sc-376264 AF546 200 µg/mL

FGF-5 (F-11) Alexa Fluor® 546

Sign In for Pricing
View Details
CRABP2 (Cellular Retinoic Acid-Binding Protein 2, Cellular Retinoic Acid-Binding Protein II, CRABPII, CRABP II, CRABP 2) discontinued
360032-01 50 µL

CRABP2 (Cellular Retinoic Acid-Binding Protein 2, Cellular Retinoic Acid-Binding Protein II, CRABPII, CRABP II, CRABP 2) discontinued

Sign In for Pricing
View Details
CRABP2 (Cellular Retinoic Acid-Binding Protein 2, Cellular Retinoic Acid-Binding Protein II, CRABPII, CRABP II, CRABP 2) discontinued
360032-02 100 µL

CRABP2 (Cellular Retinoic Acid-Binding Protein 2, Cellular Retinoic Acid-Binding Protein II, CRABPII, CRABP II, CRABP 2) discontinued

Sign In for Pricing
View Details
ZFHX1B (Zinc Finger E-Box Binding HomeoBox 2, KIAA0569, SIP-1, SIP1, SMADIP1, ZFHX1B) (MaxLight 490)
253583-ML490 100 µL

ZFHX1B (Zinc Finger E-Box Binding HomeoBox 2, KIAA0569, SIP-1, SIP1, SMADIP1, ZFHX1B) (MaxLight 490)

Sign In for Pricing
View Details
Bag-2 CRISPR Activation Plasmid (h)
sc-404540-ACT 20 µg

Bag-2 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Mouse Monoclonal Alkaline Phosphatase/ALPP Antibody (SPM593) [Alexa Fluor 488]
NBP2-47989AF488 0.1 mL

Mouse Monoclonal Alkaline Phosphatase/ALPP Antibody (SPM593) [Alexa Fluor 488]

Sign In for Pricing
View Details