Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF404 Rabbit Polyclonal Antibody (HRP)

ZNF404 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q494X3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF404

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YVCKECKKAFRSISGLSQHKRIHTGEKPYECKECDKAFNRSDRLTQHETI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001028891

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OLIG1 Polyclonal Antibody, FITC Conjugated
bs-8548R-FITC-TR 20 µL

OLIG1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Recombinant Human T-cell surface glycoprotein CD8 beta chain (CD8B)
MBS957585 Inquire

Recombinant Human T-cell surface glycoprotein CD8 beta chain (CD8B)

Sign In for Pricing
View Details
COPG Rabbit Polyclonal Antibody (HRP)
orb2105192 100 µL

COPG Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Eme1 (MTA31 7h2/1) : m-IgGκ BP-HRP Bundle
sc-520966 1 Kit

Eme1 (MTA31 7h2/1) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Lentiviral human RAB40A shRNA (UAS) - Lentiviral human RAB40A shRNA (UAS, RFP) (100)
GTR15307767 1 Vial

Lentiviral human RAB40A shRNA (UAS) - Lentiviral human RAB40A shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
OAZ1 Blocking Peptide
CBP4137-01 1 mg

OAZ1 Blocking Peptide

Sign In for Pricing
View Details