Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF404 Rabbit Polyclonal Antibody (HRP)

ZNF404 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q494X3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF404

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YVCKECKKAFRSISGLSQHKRIHTGEKPYECKECDKAFNRSDRLTQHETI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001028891

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(KO Validated) SIRT5 Polyclonal Antibody
RD89703A-01 60 μL

(KO Validated) SIRT5 Polyclonal Antibody

Sign In for Pricing
View Details
(KO Validated) SIRT5 Polyclonal Antibody
RD89703A-02 120 μL

(KO Validated) SIRT5 Polyclonal Antibody

Sign In for Pricing
View Details
(KO Validated) SIRT5 Polyclonal Antibody
RD89703A-03 200 µL

(KO Validated) SIRT5 Polyclonal Antibody

Sign In for Pricing
View Details
HIPK1 Antibody
orb1329811 100 µg

HIPK1 Antibody

Sign In for Pricing
View Details
DiagNano™ Goat Anti-Mouse IgG, QD 655 nm conjugate
GAM-G006 100 µL

DiagNano™ Goat Anti-Mouse IgG, QD 655 nm conjugate

Sign In for Pricing
View Details
Cytokeratin 19 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-2190R-BF680-TR 20 µL

Cytokeratin 19 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details