Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVX2 Rabbit Polyclonal Antibody (FITC)

EVX2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EVX-2

UniProt

Q03828

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LOC344191

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GELPAKGKFEIDTLFNLQHTGSESTVSSEISSAAESRKKPGHYSEAAAEA

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

XP_292968

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMN2 (Survival of Motor Neuron 2, Centromeric, BCD541, C-BCD541, FLJ76644, MGC20996, MGC5208, SMNC) (MaxLight 405) discontinued
251866-ML405 100 µL

SMN2 (Survival of Motor Neuron 2, Centromeric, BCD541, C-BCD541, FLJ76644, MGC20996, MGC5208, SMNC) (MaxLight 405) discontinued

Sign In for Pricing
View Details
RPL23AP77 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV778725 1.0 µg DNA

RPL23AP77 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Lentiviral human NIFK sgRNA gene knockout kit - Lentiviral human NIFK sgRNA gene knockout kit (plasmid)
GTR15378932 1 Vial

Lentiviral human NIFK sgRNA gene knockout kit - Lentiviral human NIFK sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
HPS1 ORF Vector (Human) (pORF)
ORF005069 1.0 µg DNA

HPS1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Resazurin Cell Viability Kit
TBS2001-10K 10 K Tests

Resazurin Cell Viability Kit

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0275255 (DDB_G0275255)
MBS1403186-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0275255 (DDB_G0275255)

Sign In for Pricing
View Details