Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVX2 Rabbit Polyclonal Antibody (HRP)

EVX2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EVX-2

UniProt

Q03828

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LOC344191

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GELPAKGKFEIDTLFNLQHTGSESTVSSEISSAAESRKKPGHYSEAAAEA

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

XP_292968

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NRP2 Protein (His Tag)
PDMH100178-01 20 µg

Recombinant Human NRP2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human NRP2 Protein (His Tag)
PDMH100178-02 100 µg

Recombinant Human NRP2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human NRP2 Protein (His Tag)
PDMH100178-03 500 µg

Recombinant Human NRP2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human NRP2 Protein (His Tag)
PDMH100178-04 1 mg

Recombinant Human NRP2 Protein (His Tag)

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF488A conjugate, 0.1mg/mL
BNC882615-100 1x 100 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF488A conjugate, 0.1mg/mL
BNC880152-100 1x 100 µL

CD11c (HC1/1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details