Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF81 Rabbit Polyclonal Antibody (HRP)

ZNF81 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HFZ20, MRX45, dJ54B20.6

UniProt

P51508

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF81

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QRIHTGEKPYICAECGKAFTDRSNFNKHQTIHTGDKPYKCSDCGKGFTQK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DARPP32 (PPP1R1B) pThr34 Rabbit Polyclonal Antibody
AP05890PU-N 100 µL

DARPP32 (PPP1R1B) pThr34 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DTL sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0635507 1.0 µg DNA

DTL sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Ustusol C
orb1681510 5 mg

Ustusol C

Sign In for Pricing
View Details
CYB561 siRNA (Human)
MBS8211889-01 15 nmol

CYB561 siRNA (Human)

Sign In for Pricing
View Details
CYB561 siRNA (Human)
MBS8211889-02 30 nmol

CYB561 siRNA (Human)

Sign In for Pricing
View Details
CYB561 siRNA (Human)
MBS8211889-03 5x 30 nmol

CYB561 siRNA (Human)

Sign In for Pricing
View Details