Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pdx1 Rabbit Polyclonal Antibody (FITC)

Pdx1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ip, IPF, IDX-, Ipf1, Mody, STF-, pdx-, IDX-1, IPF-1, Mody4, STF-1, pdx-1

UniProt

P52946

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LYMGRQPPPPPPPQFTSSLGSLEQGSPPDISPYEVPPLASDDPAGAHLHH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032840

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKN2D/p19 INK4d Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-5982R-PE-Cy5.5 100 µL

CDKN2D/p19 INK4d Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
iNOS (NOS2) Mouse Monoclonal Antibody [Clone ID: OTI1A1]
TA813512S 30 µL

iNOS (NOS2) Mouse Monoclonal Antibody [Clone ID: OTI1A1]

Sign In for Pricing
View Details
HeLa + heat shock Cell Lysate
sc-2272 500 µg - 200 µL

HeLa + heat shock Cell Lysate

Sign In for Pricing
View Details
UGT2B36 Lentiviral Activation Particles (m)
sc-433062-LAC 200 µL

UGT2B36 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), CF405S conjugate, 0.1mg/mL
BNC040988-100 1x 100 µL

CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CYCLIN D1 Antibody
orb2651960-01 0.1 mL

CYCLIN D1 Antibody

Sign In for Pricing
View Details