Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pdx1 Rabbit Polyclonal Antibody (Biotin)

Pdx1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ip, IPF, IDX-, Ipf1, Mody, STF-, pdx-, IDX-1, IPF-1, Mody4, STF-1, pdx-1

UniProt

P52946

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LYMGRQPPPPPPPQFTSSLGSLEQGSPPDISPYEVPPLASDDPAGAHLHH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032840

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Age 14 Days Skin Tissue Lysate
IMS14SKNTL100UG 1 Each

Mouse Age 14 Days Skin Tissue Lysate

Sign In for Pricing
View Details
Human Metastasis Associated Protein 1 (MTA1) ELISA Kit
MBS7254331-01 48 Well

Human Metastasis Associated Protein 1 (MTA1) ELISA Kit

Sign In for Pricing
View Details
Human Metastasis Associated Protein 1 (MTA1) ELISA Kit
MBS7254331-02 96 Well

Human Metastasis Associated Protein 1 (MTA1) ELISA Kit

Sign In for Pricing
View Details
Human Metastasis Associated Protein 1 (MTA1) ELISA Kit
MBS7254331-03 5x 96 Well

Human Metastasis Associated Protein 1 (MTA1) ELISA Kit

Sign In for Pricing
View Details
Human Metastasis Associated Protein 1 (MTA1) ELISA Kit
MBS7254331-04 10x 96 Well

Human Metastasis Associated Protein 1 (MTA1) ELISA Kit

Sign In for Pricing
View Details
Porcine BMP2 ELISA Kit
orb436885-01 48 Tests

Porcine BMP2 ELISA Kit

Sign In for Pricing
View Details