Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRF3 Rabbit Polyclonal Antibody (HRP)

IRF3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IIAE7

UniProt

Q14653

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human IRF3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHP

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001562

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDRT5 CRISPR Knock Out 293T Cell Line (Human)
15760141 1x 10^6 Cells / 1.0 mL

CDRT5 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
NDOR1 Protein Lysate (Mouse) with C-HA Tag
31599035 100 µg

NDOR1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Ndufb2 Rat shRNA Plasmid (Locus ID 362344)
TR707157 1 Kit

Ndufb2 Rat shRNA Plasmid (Locus ID 362344)

Sign In for Pricing
View Details
RGS1 (Regulator of G-Protein Signaling 1, RGS-1, 1R20, B Cell Activation Protein BL34, BL34, Early Response Protein 1R20, IER1, IR20) (MaxLight 490)
MBS6392447-01 0.1 mL

RGS1 (Regulator of G-Protein Signaling 1, RGS-1, 1R20, B Cell Activation Protein BL34, BL34, Early Response Protein 1R20, IER1, IR20) (MaxLight 490)

Sign In for Pricing
View Details
RGS1 (Regulator of G-Protein Signaling 1, RGS-1, 1R20, B Cell Activation Protein BL34, BL34, Early Response Protein 1R20, IER1, IR20) (MaxLight 490)
MBS6392447-02 5x 0.1 mL

RGS1 (Regulator of G-Protein Signaling 1, RGS-1, 1R20, B Cell Activation Protein BL34, BL34, Early Response Protein 1R20, IER1, IR20) (MaxLight 490)

Sign In for Pricing
View Details
pCMV-SPORT6-Dlg4 Plasmid
PVT54206 2 µg

pCMV-SPORT6-Dlg4 Plasmid

Sign In for Pricing
View Details