Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRF3 Rabbit Polyclonal Antibody (Biotin)

IRF3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IIAE7

UniProt

Q14653

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human IRF3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHP

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001562

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA3C Protein Vector (Human) (pPM-C-HA)
PV079163 500 ng

FRA3C Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
AcpH Antibody
orb809034 2 mg

AcpH Antibody

Sign In for Pricing
View Details
CB086, CT (WDPCP, BBS15, C2orf86, FRITZ, WD repeat-containing and planar cell polarity effector protein fritz homolog, Bardet-Biedl syndrome 15 protein, WD repeat-containing and planar cell polarity effector protein) (MaxLight 750) discontinued
033234-ML750 100 µL

CB086, CT (WDPCP, BBS15, C2orf86, FRITZ, WD repeat-containing and planar cell polarity effector protein fritz homolog, Bardet-Biedl syndrome 15 protein, WD repeat-containing and planar cell polarity effector protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Bromophenol red (sultone form)
HY-D0011A-01 50 mg

Bromophenol red (sultone form)

Sign In for Pricing
View Details
Bromophenol red (sultone form)
HY-D0011A-02 100 mg

Bromophenol red (sultone form)

Sign In for Pricing
View Details
Bromophenol red (sultone form)
HY-D0011A-03 250 mg

Bromophenol red (sultone form)

Sign In for Pricing
View Details