Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mafg Rabbit Polyclonal Antibody (HRP)

Mafg Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AA545192, C630022N07Rik

UniProt

O54790

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Mafg

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIIQL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEA domain family member 2 (TEAD2) (NM_001256662) Human Untagged Clone
SC330477 10 µg

TEA domain family member 2 (TEAD2) (NM_001256662) Human Untagged Clone

Sign In for Pricing
View Details
DOCK4 Antibody
16-220 100 µL

DOCK4 Antibody

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. tomato [Protein-PII] uridylyltransferase (glnD), partial
MBS1458926 Inquire

Recombinant Pseudomonas syringae pv. tomato [Protein-PII] uridylyltransferase (glnD), partial

Sign In for Pricing
View Details
Lentiviral mouse Slc16a7 shRNA (UAS) - Lentiviral mouseSlc16a7 shRNA (UAS, GFP) (25)
GTR15174980 1 Vial

Lentiviral mouse Slc16a7 shRNA (UAS) - Lentiviral mouseSlc16a7 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Recombinant Human Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 3 (LILRB3)
RPU42540-01 50 µg

Recombinant Human Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 3 (LILRB3)

Sign In for Pricing
View Details
Recombinant Human Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 3 (LILRB3)
RPU42540-02 100 µg

Recombinant Human Leukocyte Immunoglobulin Like Receptor Subfamily B, Member 3 (LILRB3)

Sign In for Pricing
View Details