Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aff1 Rabbit Polyclonal Antibody (HRP)

Aff1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

R, Af, Af4, Rob, Mllt, Mllt2h, AW319193, 9630032B01Rik

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAAHSSLYNEDRNLLRIREKERRNQEAHQEKEAFPEKAPLFPEPYKTAKG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

132kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_598680

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Primary Microglia
T4842 5x105 cells / 1 mL

Rat Primary Microglia

Sign In for Pricing
View Details
Anti-CD89/FCAR Antibody Picoband® Fluoro647 Conjugated
A07546-1-Fluoro647 100 µg/Vial

Anti-CD89/FCAR Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
ESBA-105 Biosimilar (TNFSF2 / TNFa Reference Antibody)
orb2702929-01 1 mg

ESBA-105 Biosimilar (TNFSF2 / TNFa Reference Antibody)

Sign In for Pricing
View Details
ESBA-105 Biosimilar (TNFSF2 / TNFa Reference Antibody)
orb2702929-02 5 mg

ESBA-105 Biosimilar (TNFSF2 / TNFa Reference Antibody)

Sign In for Pricing
View Details
ESBA-105 Biosimilar (TNFSF2 / TNFa Reference Antibody)
orb2702929-03 100 mg

ESBA-105 Biosimilar (TNFSF2 / TNFa Reference Antibody)

Sign In for Pricing
View Details
ZMAT4 Antibody
CSB-PA867172LA01HU-01 50 µg

ZMAT4 Antibody

Sign In for Pricing
View Details