Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAB2 Rabbit Polyclonal Antibody (HRP)

NAB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MADER

UniProt

Q15742

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NAB2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_005958

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MURF3 Overexpression Lysate (Native) - (Dry Ice)
NBL1-17305 0.1 mg

MURF3 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Hoxd4 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3942703 1.0 µg DNA

Hoxd4 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Adenosine-5-Monophoshate, free acid (AMP (yeast))
MBS682165 10 g

Adenosine-5-Monophoshate, free acid (AMP (yeast))

Sign In for Pricing
View Details
Thyroid Stimulating Hormone, beta (TSH beta, TSHb, CHNG4, Thyroid stimulating hormone beta Subunit, Thyroid stimulating hormone, beta Precursor, Thyrotropin beta chain precursor, Thyrotropin beta Subunit, TSHB) (MaxLight 650)
T5400-22F-ML650 100 µL

Thyroid Stimulating Hormone, beta (TSH beta, TSHb, CHNG4, Thyroid stimulating hormone beta Subunit, Thyroid stimulating hormone, beta Precursor, Thyrotropin beta chain precursor, Thyrotropin beta Subunit, TSHB) (MaxLight 650)

Sign In for Pricing
View Details
Onecut1 Rabbit Polyclonal Antibody (HRP)
orb2141915 100 µL

Onecut1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Sonic Hedgehog Rabbit mAb Antibody
orb1951931-01 50 µL

Sonic Hedgehog Rabbit mAb Antibody

Sign In for Pricing
View Details