Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCSK6 Rabbit Polyclonal Antibody (HRP)

PCSK6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SPC4, PACE4

UniProt

P29122

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PCSK6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGR

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_612196

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1qc (NM_007574) Mouse Recombinant Protein
E45M47929M5 20 µg

C1qc (NM_007574) Mouse Recombinant Protein

Sign In for Pricing
View Details
Tmem88b siRNA Oligos set (Mouse)
47104174 3x 5 nmol

Tmem88b siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Lentiviral human ECHDC3 sgRNA gene knockout kit - Lentiviral human ECHDC3 sgRNA gene knockout kit (25)
GTR15368193 1 Vial

Lentiviral human ECHDC3 sgRNA gene knockout kit - Lentiviral human ECHDC3 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Recombinant Mouse IL36A/IL-1F6 Protein, N-His
MV454012-01 50 µg

Recombinant Mouse IL36A/IL-1F6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse IL36A/IL-1F6 Protein, N-His
MV454012-02 100 µg

Recombinant Mouse IL36A/IL-1F6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse IL36A/IL-1F6 Protein, N-His
MV454012-03 1 mg

Recombinant Mouse IL36A/IL-1F6 Protein, N-His

Sign In for Pricing
View Details