Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAX4 Rabbit Polyclonal Antibody (HRP)

PAX4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KPD, MODY9

UniProt

O43316

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PAX4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006184

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lumican AssayLite™ Antibody (RPE Conjugate)
32276-05151 5x 30 µg

Human Lumican AssayLite™ Antibody (RPE Conjugate)

Sign In for Pricing
View Details
TYMS CRISPRa sgRNA lentivector (set of three targets)(Rat)
48890126 3x 1.0µg DNA

TYMS CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Porcine Heat Shock Protein 90kDa Alpha A1, HSP90aA1 ELISA KIT
E0319Po-01 48 Well

Porcine Heat Shock Protein 90kDa Alpha A1, HSP90aA1 ELISA KIT

Sign In for Pricing
View Details
Porcine Heat Shock Protein 90kDa Alpha A1, HSP90aA1 ELISA KIT
E0319Po-02 96 Well

Porcine Heat Shock Protein 90kDa Alpha A1, HSP90aA1 ELISA KIT

Sign In for Pricing
View Details
Porcine Heat Shock Protein 90kDa Alpha A1, HSP90aA1 ELISA KIT
E0319Po-03 5x 96 Tests

Porcine Heat Shock Protein 90kDa Alpha A1, HSP90aA1 ELISA KIT

Sign In for Pricing
View Details
Porcine Heat Shock Protein 90kDa Alpha A1, HSP90aA1 ELISA KIT
E0319Po-04 10x 96 Tests

Porcine Heat Shock Protein 90kDa Alpha A1, HSP90aA1 ELISA KIT

Sign In for Pricing
View Details