Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C8orf70 Rabbit Polyclonal Antibody (HRP)

C8orf70 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CGI-62, C8orf70, FAM164A

UniProt

Q96GY0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C8orf70

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QAARISNKGKFSTDTKGKPTSRTQVYKPPALKKSNSPGTASSGSSRLPQP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057094

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gemin4 (NM_177367) Mouse Tagged ORF Clone Lentiviral Particle
MR211558L4V 200 µL

Gemin4 (NM_177367) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
OMG CRISPR All-in-one AAV vector set (with saCas9)(Rat)
34815156 3x 1.0 µg DNA

OMG CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
CSF1R Antibody
A56630-50UL 50 μL

CSF1R Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal PTPMT1 Antibody
NBP2-13827 0.1 mL

Rabbit Polyclonal PTPMT1 Antibody

Sign In for Pricing
View Details
ME2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
28278154 3x 1.0 µg DNA

ME2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
ITGA2 (Integrin alpha 2)
216740 100 µg

ITGA2 (Integrin alpha 2)

Sign In for Pricing
View Details