Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DVL2 Rabbit Polyclonal Antibody (FITC)

DVL2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

O14641

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DVL2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_004413

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GSK3α Rabbit Monoclonal Antibody
M03152-2-20μl 20 µL

Anti-GSK3α Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SLC28A2, NT (SLC28A2, CNT2, Sodium/nucleoside cotransporter 2, Concentrative nucleoside transporter 2, Na (+) /nucleoside cotransporter 2, Sodium-coupled nucleoside transporter 2, Sodium/purine nucleoside co-transporter, Solute carrier family 28 member 2) (MaxLight 650) discontinued
041887-ML650 100 µL

SLC28A2, NT (SLC28A2, CNT2, Sodium/nucleoside cotransporter 2, Concentrative nucleoside transporter 2, Na (+) /nucleoside cotransporter 2, Sodium-coupled nucleoside transporter 2, Sodium/purine nucleoside co-transporter, Solute carrier family 28 member 2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Recombinant Strongylocentrotus purpuratus Fibropellin-1 (EGF1), partial
MBS1242746-01 0.5 mg (E-Coli)

Recombinant Strongylocentrotus purpuratus Fibropellin-1 (EGF1), partial

Sign In for Pricing
View Details
Recombinant Strongylocentrotus purpuratus Fibropellin-1 (EGF1), partial
MBS1242746-02 0.05 mg (Baculovirus)

Recombinant Strongylocentrotus purpuratus Fibropellin-1 (EGF1), partial

Sign In for Pricing
View Details
Recombinant Strongylocentrotus purpuratus Fibropellin-1 (EGF1), partial
MBS1242746-03 0.05 mg (Mammalian-Cell)

Recombinant Strongylocentrotus purpuratus Fibropellin-1 (EGF1), partial

Sign In for Pricing
View Details
Recombinant Strongylocentrotus purpuratus Fibropellin-1 (EGF1), partial
MBS1242746-04 0.5 mg (Yeast)

Recombinant Strongylocentrotus purpuratus Fibropellin-1 (EGF1), partial

Sign In for Pricing
View Details