Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pik3r1 Rabbit Polyclonal Antibody (FITC)

Pik3r1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PI, p50, p55, p85, PI3K, p50alpha, p55alpha, p85alpha

UniProt

Q80UI5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQ

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001020126

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 Fragment, Recombinant, Human (Vascular Cell Adhesion Molecule-1, VCAM-1, INCAM-110)
MBS638269-01 0.01 mg

CD106 Fragment, Recombinant, Human (Vascular Cell Adhesion Molecule-1, VCAM-1, INCAM-110)

Sign In for Pricing
View Details
CD106 Fragment, Recombinant, Human (Vascular Cell Adhesion Molecule-1, VCAM-1, INCAM-110)
MBS638269-02 5x 0.01 mg

CD106 Fragment, Recombinant, Human (Vascular Cell Adhesion Molecule-1, VCAM-1, INCAM-110)

Sign In for Pricing
View Details
CD226 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV649261 1.0 µg DNA

CD226 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SSR128129E (FGFR inhibitor)
SC1103-5mg 5 mg

SSR128129E (FGFR inhibitor)

Sign In for Pricing
View Details
MIR5087 Protein Vector (Human) (pPM-C-His)
PV098737 500 ng

MIR5087 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Rat Olfactory receptor 867 (Olr867), partial
MBS7060867 Inquire

Recombinant Rat Olfactory receptor 867 (Olr867), partial

Sign In for Pricing
View Details