Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT1 Rabbit Polyclonal Antibody (FITC)

WNT1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

INT1, OI15, BMND16

UniProt

P04628

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human WNT1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005421

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xpot Mouse Gene Knockout Kit (CRISPR)
KN519518 1 Kit

Xpot Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Zmynd15 Mouse Gene Knockout Kit (CRISPR)
KN520118 1 Kit

Zmynd15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rbx1 (NM_019712) Mouse Tagged ORF Clone
MG200390 10 µg

Rbx1 (NM_019712) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Transthyretin (Prealbumin) (CPTC-TTR-1), CF488A conjugate, 0.1mg/mL
BNC882249-500 1x 500 µL

Transthyretin (Prealbumin) (CPTC-TTR-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tedc2 Mouse Gene Knockout Kit (CRISPR)
KN500044 1 Kit

Tedc2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin Conjugated beta Amyloid 1-42 Recombinant Rabbit Monoclonal Antibody [PSH03-99]
HA722293 100 µL

Biotin Conjugated beta Amyloid 1-42 Recombinant Rabbit Monoclonal Antibody [PSH03-99]

Sign In for Pricing
View Details