Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT1 Rabbit Polyclonal Antibody (HRP)

WNT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

INT1, OI15, BMND16

UniProt

P04628

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human WNT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005421

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MACROD1 Adenovirus (Human)
27884051 1.0 mL

MACROD1 Adenovirus (Human)

Sign In for Pricing
View Details
4- (5-Chloro-1,6-dihydro-6-oxopyridazin-4-yl) piperazine, N1-CBZ protected
OR15250 1 Each

4- (5-Chloro-1,6-dihydro-6-oxopyridazin-4-yl) piperazine, N1-CBZ protected

Sign In for Pricing
View Details
USH1G Protein Vector (Mouse) (pPB-C-His)
PV244406 500 ng

USH1G Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
M6A monoclonal mouse purified IgG
202 111 100 µg

M6A monoclonal mouse purified IgG

Sign In for Pricing
View Details
RN5S151 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV743689 1.0 µg DNA

RN5S151 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rat Regulator of differentiation 1 (ROD1) ELISA Kit
MBS2805194-01 48 Tests

Rat Regulator of differentiation 1 (ROD1) ELISA Kit

Sign In for Pricing
View Details