Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT1 Rabbit Polyclonal Antibody (HRP)

WNT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

INT1, OI15, BMND16

UniProt

P04628

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human WNT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005421

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM162A Peptide
DF15168-BP 1 mg

FAM162A Peptide

Sign In for Pricing
View Details
Ccl27a (NM_001164045) Mouse Tagged Lenti ORF Clone
MR219812L4 10 µg

Ccl27a (NM_001164045) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Gpm6b (NM_001177956) Mouse Tagged ORF Clone Lentiviral Particle
MR223146L4V 200 µL

Gpm6b (NM_001177956) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human P-selectin ELISA Kit
E100263 1 Each

Human P-selectin ELISA Kit

Sign In for Pricing
View Details
Collagen Alpha-1 III Chain (COL3A1) Antibody (Biotin)
abx273288-01 200 µL

Collagen Alpha-1 III Chain (COL3A1) Antibody (Biotin)

Sign In for Pricing
View Details
Collagen Alpha-1 III Chain (COL3A1) Antibody (Biotin)
abx273288-02 1 mL

Collagen Alpha-1 III Chain (COL3A1) Antibody (Biotin)

Sign In for Pricing
View Details