Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT1 Rabbit Polyclonal Antibody (Biotin)

WNT1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

INT1, OI15, BMND16

UniProt

P04628

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human WNT1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005421

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr681 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
33357124 3x 1.0µg DNA

Olfr681 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Recombinant Mouse Lithostathine-2/Reg2 Protein (N-6His)
E53A05370 50 µg

Recombinant Mouse Lithostathine-2/Reg2 Protein (N-6His)

Sign In for Pricing
View Details
Recombinant Rat Phosphatidylinositol 3-kinase regulatory subunit beta (Pik3r2)
MBS1357737-01 0.02 mg (E-Coli)

Recombinant Rat Phosphatidylinositol 3-kinase regulatory subunit beta (Pik3r2)

Sign In for Pricing
View Details
Recombinant Rat Phosphatidylinositol 3-kinase regulatory subunit beta (Pik3r2)
MBS1357737-02 0.02 mg (Yeast)

Recombinant Rat Phosphatidylinositol 3-kinase regulatory subunit beta (Pik3r2)

Sign In for Pricing
View Details
Recombinant Rat Phosphatidylinositol 3-kinase regulatory subunit beta (Pik3r2)
MBS1357737-03 0.1 mg (Yeast)

Recombinant Rat Phosphatidylinositol 3-kinase regulatory subunit beta (Pik3r2)

Sign In for Pricing
View Details
Recombinant Rat Phosphatidylinositol 3-kinase regulatory subunit beta (Pik3r2)
MBS1357737-04 0.1 mg (E-Coli)

Recombinant Rat Phosphatidylinositol 3-kinase regulatory subunit beta (Pik3r2)

Sign In for Pricing
View Details