Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt1 Rabbit Polyclonal Antibody (HRP)

Wnt1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sw, Int, Wnt-, Int-1, Wnt-1, swaying

UniProt

P04426

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Wnt1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCN

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_067254

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM5 (NM_005778) Human Recombinant Protein
TP312543L 1 mg

RBM5 (NM_005778) Human Recombinant Protein

Sign In for Pricing
View Details
C3AR1 (NM_004054) Human Recombinant Protein
TP304730 20 µg

C3AR1 (NM_004054) Human Recombinant Protein

Sign In for Pricing
View Details
Human Kappa Light Chain (KLC709), CF640R conjugate, 0.1mg/mL
BNC400709-100 1x 100 µL

Human Kappa Light Chain (KLC709), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
trFluor™ Tb maleimide
1444-AAT 100 µg

trFluor™ Tb maleimide

Sign In for Pricing
View Details
PD-L1 Recombinant Rabbit monoclonal Antibody
HA751218 100 µL

PD-L1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Cycloxygenase-2 (COX-2) (COX2/1941), CF647 conjugate, 0.1mg/mL
BNC472377-100 1x 100 µL

Cycloxygenase-2 (COX-2) (COX2/1941), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details