Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt1 Rabbit Polyclonal Antibody (HRP)

Wnt1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sw, Int, Wnt-, Int-1, Wnt-1, swaying

UniProt

P04426

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Wnt1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCN

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_067254

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSDC2 (NM_014460) Human Recombinant Protein
TP308989 20 µg

CSDC2 (NM_014460) Human Recombinant Protein

Sign In for Pricing
View Details
Adapter pack, for 5ml and 7ml (12-13mm) tubes in 15ml rotors, 8/pk.
C3100-ADP-01 1 Each

Adapter pack, for 5ml and 7ml (12-13mm) tubes in 15ml rotors, 8/pk.

Sign In for Pricing
View Details
Adapter pack, for 5ml and 7ml (12-13mm) tubes in 15ml rotors, 8/pk.
C3100-ADP-02 1 Each

Adapter pack, for 5ml and 7ml (12-13mm) tubes in 15ml rotors, 8/pk.

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), 1mg/mL
BNUM2602-50 1x 50 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), 1mg/mL

Sign In for Pricing
View Details
EBNA1 binding protein 2 (EBNA1BP2) (NM_006824) Human Over-expression Lysate
LY402042 100 µg

EBNA1 binding protein 2 (EBNA1BP2) (NM_006824) Human Over-expression Lysate

Sign In for Pricing
View Details
N-Boc-3-ethyl L-Norvaline
TRC-B655400-250MG 250 mg

N-Boc-3-ethyl L-Norvaline

Sign In for Pricing
View Details