Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRMT3 Rabbit Polyclonal Antibody (HRP)

PRMT3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HRMT1L3

UniProt

O60678

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PRMT3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_005779

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Stromal cell derived factor 1α (SDF-1α; CXCL12) ELISA Kit
YP-W30479-01 48 Tests

Rat Stromal cell derived factor 1α (SDF-1α; CXCL12) ELISA Kit

Sign In for Pricing
View Details
Rat Stromal cell derived factor 1α (SDF-1α; CXCL12) ELISA Kit
YP-W30479-02 96 Tests

Rat Stromal cell derived factor 1α (SDF-1α; CXCL12) ELISA Kit

Sign In for Pricing
View Details
Mouse C-C motif chemokine 8 ELISA Kit
orb1668055 96 Tests

Mouse C-C motif chemokine 8 ELISA Kit

Sign In for Pricing
View Details
Mouse Blmh activation kit by CRISPRa
GA211796 1 Kit

Mouse Blmh activation kit by CRISPRa

Sign In for Pricing
View Details
METTL22 (NM_024109) Human Untagged Clone
SC112250 10 µg

METTL22 (NM_024109) Human Untagged Clone

Sign In for Pricing
View Details
Lentiviral mouse B020004C17Rik shRNA (UAS) - Lentiviral mouse B020004C17Rik shRNA (UAS, iRFP) (25)
GTR15185990 1 Vial

Lentiviral mouse B020004C17Rik shRNA (UAS) - Lentiviral mouse B020004C17Rik shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details