Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF706 Rabbit Polyclonal Antibody (Biotin)

ZNF706 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HSPC038, PNAS-106, PNAS-113

UniProt

Q9Y5V0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF706

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

8kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057180

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frk, CT (Frk, Bsk, Iyk, Tyrosine-protein kinase FRK, Beta-cell Src-homology tyrosine kinase, FYN-related kinase, Intestine tyrosine kinase) (MaxLight 750)
MBS6300134-01 0.1 mL

Frk, CT (Frk, Bsk, Iyk, Tyrosine-protein kinase FRK, Beta-cell Src-homology tyrosine kinase, FYN-related kinase, Intestine tyrosine kinase) (MaxLight 750)

Sign In for Pricing
View Details
Frk, CT (Frk, Bsk, Iyk, Tyrosine-protein kinase FRK, Beta-cell Src-homology tyrosine kinase, FYN-related kinase, Intestine tyrosine kinase) (MaxLight 750)
MBS6300134-02 5x 0.1 mL

Frk, CT (Frk, Bsk, Iyk, Tyrosine-protein kinase FRK, Beta-cell Src-homology tyrosine kinase, FYN-related kinase, Intestine tyrosine kinase) (MaxLight 750)

Sign In for Pricing
View Details
TRAPPC1 Antibody
46278-01 50 µL

TRAPPC1 Antibody

Sign In for Pricing
View Details
TRAPPC1 Antibody
46278-02 100 µL

TRAPPC1 Antibody

Sign In for Pricing
View Details
Influenza H7N9 Hemagglutinin/HA ELISA Kit
MBS8123981-01 96 Tests

Influenza H7N9 Hemagglutinin/HA ELISA Kit

Sign In for Pricing
View Details
Influenza H7N9 Hemagglutinin/HA ELISA Kit
MBS8123981-02 5x 96 Tests

Influenza H7N9 Hemagglutinin/HA ELISA Kit

Sign In for Pricing
View Details