Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF526 Rabbit Polyclonal Antibody (HRP)

ZNF526 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZp762O059, KIAA1951, MGC4267

UniProt

Q8TF50

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF526

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPTPLPPPSPPSEVKMEPYECPECSTLCATPEEFLEHQGTHFDSLEKEER

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_597701

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Chaperonin 10 ELISA Kit
MBS017573 Inquire

Chicken Chaperonin 10 ELISA Kit

Sign In for Pricing
View Details
CHRM2 (NM_001006629) Human Tagged ORF Clone
RG211436 10 µg

CHRM2 (NM_001006629) Human Tagged ORF Clone

Sign In for Pricing
View Details
Carbon Nanotube Bundled Multi-walled
CA2370-01 1 g

Carbon Nanotube Bundled Multi-walled

Sign In for Pricing
View Details
Carbon Nanotube Bundled Multi-walled
CA2370-02 5 g

Carbon Nanotube Bundled Multi-walled

Sign In for Pricing
View Details
Mouse Monoclonal S100A13 Antibody (S100A13/7484) [Alexa Fluor 532]
NBP3-27005AF532 0.1 mL

Mouse Monoclonal S100A13 Antibody (S100A13/7484) [Alexa Fluor 532]

Sign In for Pricing
View Details
CRBN Polyclonal Antibody Cy3 Conjugated
MBS9460418-01 0.1 mL

CRBN Polyclonal Antibody Cy3 Conjugated

Sign In for Pricing
View Details