Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp90 Rabbit Polyclonal Antibody (HRP)

Zfp90 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NK1, KRAB, NK10, Zfp6, Zfp8, Zfp64, Zfp83, KRAB17, mKIAA1954, 6430515L01Rik

UniProt

Q61967

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HLVSLGYQVSKPEVIFKLEQGEEPWISEKEIQRPFCPDWKTRPESSRSPQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035894

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PP1C gamma (PPP1CC) Rabbit Polyclonal Antibody (N-term)
E28PB2587 100 µL

PP1C gamma (PPP1CC) Rabbit Polyclonal Antibody (N-term)

Sign In for Pricing
View Details
Cyclophilin F discontinued
535273-01 30ul

Cyclophilin F discontinued

Sign In for Pricing
View Details
Cyclophilin F discontinued
535273-02 100 µL

Cyclophilin F discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal PLEKHA2 Antibody [DyLight 594]
NBP3-06069DL594 0.1 mL

Rabbit Polyclonal PLEKHA2 Antibody [DyLight 594]

Sign In for Pricing
View Details
UPF3A (NM_023011) Human Over-expression Lysate
LH11831V 100 µg

UPF3A (NM_023011) Human Over-expression Lysate

Sign In for Pricing
View Details
IFNA2 (Interferon, alpha 2, IFNA, INFA2, MGC125764, MGC125765) (APC)
247435-APC 100 µL

IFNA2 (Interferon, alpha 2, IFNA, INFA2, MGC125764, MGC125765) (APC)

Sign In for Pricing
View Details