Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp90 Rabbit Polyclonal Antibody (HRP)

Zfp90 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NK1, KRAB, NK10, Zfp6, Zfp8, Zfp64, Zfp83, KRAB17, mKIAA1954, 6430515L01Rik

UniProt

Q61967

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HLVSLGYQVSKPEVIFKLEQGEEPWISEKEIQRPFCPDWKTRPESSRSPQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035894

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-P180 Lamellar Body Protein/ABCA3 Antibody
PA2259 100 µg/Vial

Anti-P180 Lamellar Body Protein/ABCA3 Antibody

Sign In for Pricing
View Details
Cytokeratin 8 CRISPR/Cas9 KO Plasmid (h)
sc-418254 20 µg

Cytokeratin 8 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Hoxc9 Protein Vector (Rat) (pPB-C-His)
PV273302 500 ng

Hoxc9 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
BAGE3 Antibody
A42251-100UG 100 µg

BAGE3 Antibody

Sign In for Pricing
View Details
Dctn5 Rat shRNA Plasmid (Locus ID 308961)
TL703557 1 Kit

Dctn5 Rat shRNA Plasmid (Locus ID 308961)

Sign In for Pricing
View Details
Slc12a6 3'UTR Lenti-reporter-Luc Vector
43875086 1.0 µg

Slc12a6 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details