Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF639 Rabbit Polyclonal Antibody (HRP)

ZNF639 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZASC1, ANC-2H01, ANC_2H01

UniProt

Q9UID6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF639

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MNEYPKKRKRKTLHPSRYSDSSGISRIADGFNGIFSDHCYSVCSMRQPDL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057415

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VC100bp DNA Ladder, 5 x 50µg
NL1402 5 x 50μg

VC100bp DNA Ladder, 5 x 50µg

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS634236 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
RAGE (AGER) Rabbit Polyclonal Antibody
TA373343 100 µL

RAGE (AGER) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FCGRT Rabbit Polyclonal Antibody
HA500006 100 µL

FCGRT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CHM Goat Polyclonal Antibody
AB0123-500 2 mg

CHM Goat Polyclonal Antibody

Sign In for Pricing
View Details
Interleukin 34 (IL34) (NM_001172771) Human Over-expression Lysate
LY432749 100 µg

Interleukin 34 (IL34) (NM_001172771) Human Over-expression Lysate

Sign In for Pricing
View Details