Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF3 Rabbit Polyclonal Antibody (HRP)

KLF3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BKLF

UniProt

P57682

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLF3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSHGIQMEPVDLTVNKRSSPPSAGNSPSSLKFPSSHRRASPGLSMPSSSP

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057615

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Exportin-2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61865R-BF405-01 20 µL

Exportin-2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Exportin-2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61865R-BF405-02 100 µL

Exportin-2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
DNTNP Rabbit Polyclonal Antibody (Biotin)
orb457313 100 µL

DNTNP Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Anti-GABA Transporter (GAT) 2 Antibody
881-GAT2t 25 µL

Anti-GABA Transporter (GAT) 2 Antibody

Sign In for Pricing
View Details
Anti-M13/fd/F1 FITC, B62-FE2, mouse mab
61497 250 µL

Anti-M13/fd/F1 FITC, B62-FE2, mouse mab

Sign In for Pricing
View Details
Goat enin Alpha 2 (CTNNA2) ELISA kit
GTR10430644 96 Well

Goat enin Alpha 2 (CTNNA2) ELISA kit

Sign In for Pricing
View Details