Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP384 Rabbit Polyclonal Antibody (Biotin)

ZFP384 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ciz, Nmp4, Znf384

UniProt

Q9EQJ4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of RAT Znf384

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EKGCGLAPPHYPTLLTVPASVSLSSGISMDTESKSEQLTPHSQASVTQNI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_596920

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IREB1 Peptide
AF4711-BP 1 mg

IREB1 Peptide

Sign In for Pricing
View Details
MTUS2 Rabbit Polyclonal Antibody (BF647)
orb2485049 100 µL

MTUS2 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
4 Months of Cell Insurance
C192 4 Months

4 Months of Cell Insurance

Sign In for Pricing
View Details
Anti-Otx2 Antibody Picoband® (Dylight488 Conjugate)
PB9344-Dylight488 100 µg

Anti-Otx2 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
B3GNT8 Rabbit Polyclonal Antibody
orb316549 100 µg

B3GNT8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Nkx2-5 (Homeobox Protein Nkx-25, Cardiac-specific Homeobox, Homeobox Protein CSX, Homeobox Protein NK-2 Homolog E, Nkx2-5, Csx, Nkx-25, Nkx2e) (HRP) discontinued
302600-HRP 200 µL

Nkx2-5 (Homeobox Protein Nkx-25, Cardiac-specific Homeobox, Homeobox Protein CSX, Homeobox Protein NK-2 Homolog E, Nkx2-5, Csx, Nkx-25, Nkx2e) (HRP) discontinued

Sign In for Pricing
View Details