Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF280B Rabbit Polyclonal Antibody (HRP)

ZNF280B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SUHW2, ZNF279, ZNF632, 5'OY11.1, D87009.C22.3

UniProt

Q86YH2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEEKEPEPQKNIQETKQVDDEDAELIFVGVEHVNEDAELIFVGVTSNSKP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_542942

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aldol® 467 beta-D-galactopyranoside, Biosynth Patent: EP 2427431 and US 8940909
EA175335-01 1 g

Aldol® 467 beta-D-galactopyranoside, Biosynth Patent: EP 2427431 and US 8940909

Sign In for Pricing
View Details
Aldol® 467 beta-D-galactopyranoside, Biosynth Patent: EP 2427431 and US 8940909
EA175335-02 2.5 g

Aldol® 467 beta-D-galactopyranoside, Biosynth Patent: EP 2427431 and US 8940909

Sign In for Pricing
View Details
Aldol® 467 beta-D-galactopyranoside, Biosynth Patent: EP 2427431 and US 8940909
EA175335-03 5 g

Aldol® 467 beta-D-galactopyranoside, Biosynth Patent: EP 2427431 and US 8940909

Sign In for Pricing
View Details
Aldol® 467 beta-D-galactopyranoside, Biosynth Patent: EP 2427431 and US 8940909
EA175335-04 10 g

Aldol® 467 beta-D-galactopyranoside, Biosynth Patent: EP 2427431 and US 8940909

Sign In for Pricing
View Details
Xpress™ Human C22ORF29 Over-expressing Stable Cell Line
ABC-X0392 1 Vial

Xpress™ Human C22ORF29 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
Trim10 (NM_011280) Mouse Recombinant Protein
PM46065M5 20 µg

Trim10 (NM_011280) Mouse Recombinant Protein

Sign In for Pricing
View Details