Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR2F6 Rabbit Polyclonal Antibody (Biotin)

NR2F6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EAR2, EAR-2, ERBAL2

UniProt

P10588

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_005225

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DiagNano™ Gold Nanoparticles, 250 nm
BG-250-01 20 mL

DiagNano™ Gold Nanoparticles, 250 nm

Sign In for Pricing
View Details
DiagNano™ Gold Nanoparticles, 250 nm
BG-250-02 100 mL

DiagNano™ Gold Nanoparticles, 250 nm

Sign In for Pricing
View Details
5730507C01Rik Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
10805065 1.0 µg DNA

5730507C01Rik Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
AKR1B1 Knockout AGS Polyclonal Cells
ARG26517 1 Million

AKR1B1 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
UBQLN2, NT (Ubiquilin 2, Protein Linking IAP with Cytoskeleton-2, PLIC-2, hPLIC-2, Ubiquitin-like Product Chap1/Dsk2, DSK2 Homolog, Chap1, N4BP4, PLIC2, HRIHFB2157) (MaxLight 650)
MBS6504548-01 0.1 mL

UBQLN2, NT (Ubiquilin 2, Protein Linking IAP with Cytoskeleton-2, PLIC-2, hPLIC-2, Ubiquitin-like Product Chap1/Dsk2, DSK2 Homolog, Chap1, N4BP4, PLIC2, HRIHFB2157) (MaxLight 650)

Sign In for Pricing
View Details
UBQLN2, NT (Ubiquilin 2, Protein Linking IAP with Cytoskeleton-2, PLIC-2, hPLIC-2, Ubiquitin-like Product Chap1/Dsk2, DSK2 Homolog, Chap1, N4BP4, PLIC2, HRIHFB2157) (MaxLight 650)
MBS6504548-02 5x 0.1 mL

UBQLN2, NT (Ubiquilin 2, Protein Linking IAP with Cytoskeleton-2, PLIC-2, hPLIC-2, Ubiquitin-like Product Chap1/Dsk2, DSK2 Homolog, Chap1, N4BP4, PLIC2, HRIHFB2157) (MaxLight 650)

Sign In for Pricing
View Details