Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Esrra Rabbit Polyclonal Antibody (FITC)

Esrra Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Er, Es, Nr3, Err1, Nr3b1, Estrra, ERRalpha

UniProt

O08580

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_031979

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat C-Type Lectin Domain Containing 6A (CLEC6A) ELISA Kit
abx507146 96 Tests

Rat C-Type Lectin Domain Containing 6A (CLEC6A) ELISA Kit

Sign In for Pricing
View Details
Anti-GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody Picoband® (FITC Conjugate)
PB9627-FITC 100 µg/Vial

Anti-GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody Picoband® (FITC Conjugate)

Sign In for Pricing
View Details
Human PCCB knockdown cell line
ABC-KD11179 1 Vial

Human PCCB knockdown cell line

Sign In for Pricing
View Details
Rat Bscl2 Pre-designed siRNA Set B
SI201547B 1 Each

Rat Bscl2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse Monoclonal Collagen II Antibody (2) [mFluor Violet 450 SE]
NBP1-05169MFV450 0.1 mL

Mouse Monoclonal Collagen II Antibody (2) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Recombinant Bradyrhizobium sp. UDP-N-acetylenolpyruvoylglucosamine reductase (murB)
MBS1035683-01 0.02 mg (E-Coli)

Recombinant Bradyrhizobium sp. UDP-N-acetylenolpyruvoylglucosamine reductase (murB)

Sign In for Pricing
View Details