Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Esrra Rabbit Polyclonal Antibody (FITC)

Esrra Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Er, Es, Nr3, Err1, Nr3b1, Estrra, ERRalpha

UniProt

O08580

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_031979

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIDA-set siRNA/shRNA/RNAi Lentivector (Human)
11595091 4x 500 ng

AIDA-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
LECT2, NT (Leukocyte Cell-derived Chemotaxin-2, LECT-2, hLECT2, chm2, chm-II, MGC126628) (MaxLight 405)
MBS6484739-01 0.1 mL

LECT2, NT (Leukocyte Cell-derived Chemotaxin-2, LECT-2, hLECT2, chm2, chm-II, MGC126628) (MaxLight 405)

Sign In for Pricing
View Details
LECT2, NT (Leukocyte Cell-derived Chemotaxin-2, LECT-2, hLECT2, chm2, chm-II, MGC126628) (MaxLight 405)
MBS6484739-02 5x 0.1 mL

LECT2, NT (Leukocyte Cell-derived Chemotaxin-2, LECT-2, hLECT2, chm2, chm-II, MGC126628) (MaxLight 405)

Sign In for Pricing
View Details
N-[4- (5-Chloro-benzooxazol-2-yl) -phenyl]-3-nitro-benzamide
sc-338209 1 mg

N-[4- (5-Chloro-benzooxazol-2-yl) -phenyl]-3-nitro-benzamide

Sign In for Pricing
View Details
Contactin 2 (CNTN2) Porcine ELISA Kit
C4346 96 Tests

Contactin 2 (CNTN2) Porcine ELISA Kit

Sign In for Pricing
View Details
Inhibin INHA Human ELISA Kit
90122 96 Tests

Inhibin INHA Human ELISA Kit

Sign In for Pricing
View Details