Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESRRB Rabbit Polyclonal Antibody (HRP)

ESRRB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ERR2, ERRb, ESRL2, NR3B2, DFNB35, ERRbeta2, ERR beta-2

UniProt

O95718

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ESRRB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004443

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbonic Anhydrase VIII Antibody / CA8
V8822-100UG 100 µg

Carbonic Anhydrase VIII Antibody / CA8

Sign In for Pricing
View Details
Rabbit Defensin Alpha 5 Paneth Cell Specific ELISA Kit
MBS730873-01 48 Well

Rabbit Defensin Alpha 5 Paneth Cell Specific ELISA Kit

Sign In for Pricing
View Details
Rabbit Defensin Alpha 5 Paneth Cell Specific ELISA Kit
MBS730873-02 96 Well

Rabbit Defensin Alpha 5 Paneth Cell Specific ELISA Kit

Sign In for Pricing
View Details
Rabbit Defensin Alpha 5 Paneth Cell Specific ELISA Kit
MBS730873-03 5x 96 Well

Rabbit Defensin Alpha 5 Paneth Cell Specific ELISA Kit

Sign In for Pricing
View Details
Rabbit Defensin Alpha 5 Paneth Cell Specific ELISA Kit
MBS730873-04 10x 96 Well

Rabbit Defensin Alpha 5 Paneth Cell Specific ELISA Kit

Sign In for Pricing
View Details
KIT Antibody (Center Y568/Y570) Blocking Peptide
MBS9224247-01 0.5 mg

KIT Antibody (Center Y568/Y570) Blocking Peptide

Sign In for Pricing
View Details