Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF25 Rabbit Polyclonal Antibody (FITC)

ZNF25 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Zfp9, KOX19

UniProt

P17030

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF25

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SFSQKSHFIIHQRKHTGEKPYECQECGETFIQKSQLTAHQKTHTKKRNAE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_659448

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human LH (Luteinizing Hormone) ELISA Kit
E-UNEL-H0014-01 5x 96 Tests

Uncoated Human LH (Luteinizing Hormone) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human LH (Luteinizing Hormone) ELISA Kit
E-UNEL-H0014-02 15x 96 Tests

Uncoated Human LH (Luteinizing Hormone) ELISA Kit

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (CIP1/2275R), CF488A conjugate, 0.1mg/mL
BNC882275-100 1x 100 µL

P21WAF1 (Tumor Suppressor Protein) (CIP1/2275R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Basic (Type II or HMW) (Epithelial Marker) (KRTH/1576R), CF568 conjugate, 0.1mg/mL
BNC681576-500 1x 500 µL

Cytokeratin, Basic (Type II or HMW) (Epithelial Marker) (KRTH/1576R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human HGF Antibody Pair Set
E-KAB-0032 50 µL & 100 µg

Human HGF Antibody Pair Set

Sign In for Pricing
View Details
Progesterone (6-5E-3F), CF568 conjugate, 0.1mg/mL
BNC680236-500 1x 500 µL

Progesterone (6-5E-3F), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details