Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZUP1 Rabbit Polyclonal Antibody (FITC)

ZUP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DUB, ZUFSP, C6orf113

UniProt

Q96AP4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C6orf113

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RQEIEEFQKLQRQYGLDNSGGYKQQQLRNMEIEVNRGRMPPSEFHRRKAD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_659499

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ndufa12 shRNA (UAS) - Lentiviral mouseNdufa12 shRNA (UAS, GFP) (25)
GTR15204296 1 Vial

Lentiviral mouse Ndufa12 shRNA (UAS) - Lentiviral mouseNdufa12 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
MTND2P9 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV734848 1.0 µg DNA

MTND2P9 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
ITGAV sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0007207 1.0 µg DNA

ITGAV sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse Monoclonal FABP2/I-FABP Antibody (OTI2C4) [mFluor Violet 610 SE]
NBP2-70699MFV610 0.1 mL

Mouse Monoclonal FABP2/I-FABP Antibody (OTI2C4) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Chicken Nuclear Factor 1 C Type (NFIC) ELISA Kit
MBS7264996-01 48 Well

Chicken Nuclear Factor 1 C Type (NFIC) ELISA Kit

Sign In for Pricing
View Details
Chicken Nuclear Factor 1 C Type (NFIC) ELISA Kit
MBS7264996-02 96 Well

Chicken Nuclear Factor 1 C Type (NFIC) ELISA Kit

Sign In for Pricing
View Details