Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZUP1 Rabbit Polyclonal Antibody (HRP)

ZUP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DUB, ZUFSP, C6orf113

UniProt

Q96AP4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C6orf113

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RQEIEEFQKLQRQYGLDNSGGYKQQQLRNMEIEVNRGRMPPSEFHRRKAD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_659499

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Influenza A H5N1 Hemagglutinin Antibody (1E6A7) [Alexa Fluor 750]
NBP1-75493AF750 0.1 mL

Mouse Monoclonal Influenza A H5N1 Hemagglutinin Antibody (1E6A7) [Alexa Fluor 750]

Sign In for Pricing
View Details
Src Rabbit Monoclonal Antibody
AMRe21265-01 50 µL

Src Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Src Rabbit Monoclonal Antibody
AMRe21265-02 100 µL

Src Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Src Rabbit Monoclonal Antibody
AMRe21265-03 200 µL

Src Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human GAMT Protein, His Tag
KMH1147-01 100 µg

Recombinant Human GAMT Protein, His Tag

Sign In for Pricing
View Details
Recombinant Human GAMT Protein, His Tag
KMH1147-02 50 µg

Recombinant Human GAMT Protein, His Tag

Sign In for Pricing
View Details